PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G097200.2.p
Common NamePRUPE_ppa008351mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bHLH
Protein Properties Length: 352aa    MW: 38882.2 Da    PI: 5.9335
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G097200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH253.3e-08284324344
                         HHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHH CS
                 HLH   3 rahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiL 44 
                         ++h + E+ RR ++N +++ Lr+l+P+++    + +sK  iL
  Prupe.2G097200.2.p 284 TKHFATEKHRRVQLNGKYSALRDLVPNPT-KVYTSNSKFHIL 324
                         78*************************82.444558888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.991281334IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.66E-7282335IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.1E-5284324IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000830.00117284313No hitNo description
Gene3DG3DSA:4.10.280.101.3E-5284325IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0048658Biological Processanther wall tapetum development
GO:0052543Biological Processcallose deposition in cell wall
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MYEDTVGCNF DQNSMPESAE SVLNLNPLPP PPPPQVLMPS PSETHNNNNN NSFAVAENLR  60
LSMEELSYPH QQDHHAAMEI ELQNELGFNP YSTNTDQNNH SSHLVSFEQP TNWDNIHGVH  120
DQMQQQLQDG ANGPYPPTPD LLNLFSLPRC SPSSVLQNSS INFTNPNPKS SNFPNSLGFL  180
GDVHGGIDTP PGTASSVLYD PLFHLNLPPQ PPLFRELLQS LPHGYSLPGS RNGSLFSSGG  240
DDREGIGGGV YSDGINNGRQ FENGVLEFSR EMGSIGRGRD VKGTKHFATE KHRRVQLNGK  300
YSALRDLVPN PTKVYTSNSK FHILSLQKYM LLNLIKFHEK MHISCFEVLI G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6894080.0KP689408.1 Prunus pseudocerasus isolate CL2155.2 bHLH transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007218278.10.0hypothetical protein PRUPE_ppa008351mg
TrEMBLM5X0930.0M5X093_PRUPE; Uncharacterized protein
STRINGVIT_15s0107g00380.t015e-67(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31210.16e-21bHLH family protein